Cart summary

You have no items in your shopping cart.

RBM47 Rabbit Polyclonal Antibody (HRP)

RBM47 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2124653

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124653
CategoryAntibodies
DescriptionRBM47 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RBM47
Protein SequenceSynthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
UniProt IDA0AV96
MW57kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNET18
NoteFor research use only
NCBINP_061900
  • RBM47 Rabbit Polyclonal Antibody (HRP) [orb473885]

    IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl