RBM10 Rabbit Polyclonal Antibody

• Catalog Number: orb573578
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBM10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 104 kDa
• Target: RBM10
• UniProt ID: P98175
• Protein Sequence: Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
• NCBI: NP_005667
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is also present at 94 kDa. The protein is modified by phosphorylation.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Rat liver (R-LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

RBM10 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573578 with 1:200 dilution. Western blot was performed using orb573578 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: RBM10 IP with orb573578 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-RBM10 Antibody Titration: 1.4 ug/ml, ELISA Titer: 1:1562500, Positive Control: Daudi cell lysate, RBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.