RBBP8 Rabbit Polyclonal Antibody

• Catalog Number: orb581252
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBBP8
• Target: RBBP8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP8
• Protein Sequence: Synthetic peptide located within the following region: ETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEE
• UniProt ID: A6NKN2
• MW: 98kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RIM, COM1, CTIP, JWDS, SAE2, SCKL2
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_976037

Sample Type: 1. HCT116 lysate (50 ug), 2. MCF7 lysate (50 ug), 3. rCtIP (30 ng), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit IR700, Secondary dilution: 1:5000.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.