Rasl10a Rabbit Polyclonal Antibody

• Catalog Number: orb581608
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rasl10a
• Target: Rasl10a
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: TAIIRQFLFGDYPERHRPTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGS
• UniProt ID: Q8K5A4
• MW: 23kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AI852688, 2210403B10Rik
• Note: For research use only
• NCBI: NP_660251

Antibody dilution: 1.0 ug/ml, Sample Type: Mouse Lung.