Cart summary

You have no items in your shopping cart.

RALGPS1 Rabbit Polyclonal Antibody (Biotin)

RALGPS1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2122225

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122225
CategoryAntibodies
DescriptionRALGPS1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RALGPS1
Protein SequenceSynthetic peptide located within the following region: AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL
UniProt IDQ5JS13
MW62kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRALGEF2, RALGPS1A
NoteFor research use only
NCBINP_055451