Cart summary

You have no items in your shopping cart.

RAI16 Rabbit Polyclonal Antibody (FITC)

RAI16 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2101284

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101284
CategoryAntibodies
DescriptionRAI16 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RAI16
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW82kDa
UniProt IDQ86V87
Protein SequenceSynthetic peptide located within the following region: HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL
NCBINP_073586
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesRAI16, FAM160B2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.