Cart summary

You have no items in your shopping cart.

RAET1G Rabbit Polyclonal Antibody (FITC)

RAET1G Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2091237

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2091237
CategoryAntibodies
DescriptionRAET1G Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human RAET1G
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW34kDa
UniProt IDQ6H3X3
Protein SequenceSynthetic peptide located within the following region: HPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGA
NCBINP_001001788
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesULBP5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.