Rabbit polyclonal antibodies to CD4

• Catalog Number: orb2284540
• Category: Antibodies
• Description: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages
• Target: CD4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Isotype: IgG/IgM
• Conjugation: Unconjugated
• Reactivity: Human
• Form/Appearance: Liquid
• Concentration: Batch dependent within range 2.0-2.5 mg/mL
• Buffer/Preservatives: Glycine pH 7.2
• Purification: Immunogen affinity column
• Immunogen: IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI - αα 412-458
• UniProt ID: P01730
• MW: 51 111
• Tested applications: ELISA, WB
• Dilution range: Western blot: 0.1-1.0 µg/ml
• Cross Reactivity: May cross-react with other species
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000607.1
• Expiration Date: 12 months from date of receipt.

Western blot demonstrating our polyclonal detecting recombinant human CD4 (P01730) at 1 in 2000 dilution. Lane 1: Marker; Lane 2: CD4 (1ng); Lane 3: CD4 (5ng); Lane 4: CD4 (10ng); Lane 5: CD4 (50ng).

ELISA Plates were coated with 1 µg/mL recombinant human CD4 protein, our polyclonal anti-CD4 was added at different concentrations and detected with an anti-rabbit HRP.