You have no items in your shopping cart.
Rab9b Antibody
Description
Images & Validation
−| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:250-1:2,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 115 aa to the C-terminus of Rab9b produced in E. coli. Antigen Sequence: EFMDPDHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKASSSCC |
| Target | RAB9B, member RAS oncogene family |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Rab9 Antibody [orb153350]
WB
Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Goat
Polyclonal
Unconjugated
100 μgRAB9B Rabbit Polyclonal Antibody [orb583358]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlRab9b Rabbit Polyclonal Antibody [orb583359]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of Raw264.7, MDCK, Jurkat cell line lysate using Rab9b antibody.
Quick Database Links
Documents Download
Request a Document
Rab9b Antibody (orb153351)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



