Rab9b Antibody

SKU: orb153351

Description

Goat polyclonal antibody to mouse Rab9b. Rab9 belongs to the small GTPase superfamily, Rab family. This protein may be involved in endosome-to-Golgi transport.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:250-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to the C-terminus of Rab9b produced in E. coli.. Antigen Sequence: EFMDPDHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKASSSCC
• Target: RAB9B, member RAS oncogene family
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

RAB9, Rab9B, RAB9L, Rab-9L, RAB9-like protein, ras-related protein Rab-9B antibody.

Western blot analysis of Raw264.7, MDCK, Jurkat cell line lysate using Rab9b antibody.

Quick Database Links

Gene Symbol

RAB9B, member RAS oncogene family