RAB8A Rabbit Polyclonal Antibody

• Catalog Number: orb331583
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB8A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB8A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: RAB8A
• UniProt ID: P61006
• Protein Sequence: Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
• NCBI: NP_005361
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MEL antibody, anti RAB8 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

RAB8A antibody - middle region (orb331583) validated by WB using 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), 3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15 ug) at 1:1000.

WB Suggested Anti-RAB8A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, RAB8A is supported by BioGPS gene expression data to be expressed in 721_B.