Cart summary

You have no items in your shopping cart.

RAB42 Rabbit Polyclonal Antibody (HRP)

RAB42 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2087429

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087429
CategoryAntibodies
DescriptionRAB42 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Guinea pig, Human, Mouse, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB42
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW24kDa
Protein SequenceSynthetic peptide located within the following region: AFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
NCBINP_001180461
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesRP4-669K10.6
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.