You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582031 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB3IP |
Target | RAB3IP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RAB3IP |
Protein Sequence | Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD |
UniProt ID | Q96QF0 |
MW | 53kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | RABIN3, RABIN8 |
Note | For research use only |
NCBI | NP_783322 |
Application: Immunofluorescence, Species+tissue/cell type: Mouse retina tissue, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexafluor 568, Secondary antibody dilution: 1:200.
WB Suggested Anti-RAB3IP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: NCI-H226 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |