Rab28 Antibody

SKU: orb11632

Description

RAB28 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking.

Images & Validation

• Tested Applications: IF, WB
• Dilution range: WB:1:250-1:2,000, IF:1:25-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab28 produced in E. coli.. Antigen Sequence: MSETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ
• Target: RAB28, member RAS oncogene family
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

RAB1C, GTP-binding protein RAY, H-ray, ras-related protein Rab-35; ras-related protein rab-1C and RAY antibody.

Western blot analysis of transfected 293HEK cell lysate using Rab28 antibody.

Confocal immunofluoroscence analysis of RPE cells using Rab28 antibody.

Quick Database Links

Gene Symbol

RAB28, member RAS oncogene family