You have no items in your shopping cart.
Rab28 Antibody
Description
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Dilution Range | WB:1:250-1:2,000, IF:1:25-1:250 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab28 produced in E. coli. Antigen Sequence: MSETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ |
| Target | RAB28, member RAS oncogene family |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RAB28 Antibody (Center) [orb1934439]
FC, IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μlRAB28 rabbit pAb Antibody [orb772995]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of transfected 293HEK cell lysate using Rab28 antibody.

Confocal immunofluoroscence analysis of RPE cells using Rab28 antibody.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Rab28 Antibody (orb11632)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














