Rab27b Rabbit Polyclonal Antibody

• Catalog Number: orb583219
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rab27b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: Rab27b
• UniProt ID: Q99P58
• Protein Sequence: Synthetic peptide located within the following region: YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE
• NCBI: NP_085031
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 2310021G14Rik, B130064M09Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rab27b antibody - C-terminal region (orb583219) validated by WB using Mouse Heart lysate at 1 ug/ml.

WB Suggested Anti-Rab27b Antibody, Titration: 0.5 ug/ml, Positive Control: human testis, mouse liver, brain and testis.