Rab27b Rabbit Polyclonal Antibody

SKU: orb583219

Description

Rabbit polyclonal antibody to Rab27b

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Rab27b
• Protein Sequence: Synthetic peptide located within the following region: YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

2310021G14Rik, B130064M09Rik

Rab27b antibody - C-terminal region (orb583219) validated by WB using Mouse Heart lysate at 1 ug/ml.

WB Suggested Anti-Rab27b Antibody, Titration: 0.5 ug/ml, Positive Control: human testis, mouse liver, brain and testis.

Quick Database Links

Gene Symbol

Rab27b

UniProt

Q99P58

RefSeq (Protein):NP_085031