You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583566 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB22A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAB22A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | RAB22A |
UniProt ID | P35285 |
Protein Sequence | Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
NCBI | NP_065724 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MGC16770 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Murin JAWS-II cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody dilution: 1:1500.
WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate. RAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
ELISA, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Canine, Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |