RAB22A Rabbit Polyclonal Antibody

• Catalog Number: orb583566
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB22A
• Target: RAB22A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A
• Protein Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
• UniProt ID: P35285
• MW: 22kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MGC16770
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_065724
• Expiration Date: 12 months from date of receipt.

Lanes: Murin JAWS-II cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody dilution: 1:1500.

WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate. RAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.