RAB11A Rabbit Polyclonal Antibody

SKU: orb585750

Description

Rabbit polyclonal antibody to RAB11A

Research Area

Cell Biology

Images & Validation

−

Item 1 of 5

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	RAB11A
Protein Sequence	Synthetic peptide located within the following region: NVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK
Molecular Weight	24kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

YL8

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

human Hela Cells and Monkey Vera.

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: Rab11a.

RAB11A antibody - C-terminal region (orb585750) validated by WB using Placenta Lysate at 1 ug/ml.

Rabbit Anti-RAB11A Antibody, Catalog Number: orb585750, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane in intercalated disc, cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAB11A Antibody, Positive Control: Lane 1: 60 ug human NT2 cell line Lane 2: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody dilution: 1:20000.

Quick Database Links

Gene Symbol

RAB11A

UniProt

P62491

RefSeq (Protein):NP_004654

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004654

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols