You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585750 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB11A |
Target | RAB11A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: NVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK |
UniProt ID | P62491 |
MW | 24kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | YL8 |
Note | For research use only |
NCBI | NP_004654 |
human Hela Cells and Monkey Vera.
Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: Rab11a.
RAB11A antibody - C-terminal region (orb585750) validated by WB using Placenta Lysate at 1 ug/ml.
Rabbit Anti-RAB11A Antibody, Catalog Number: orb585750, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane in intercalated disc, cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-RAB11A Antibody, Positive Control: Lane 1: 60 ug human NT2 cell line Lane 2: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody dilution: 1:20000.
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Mouse, Porcine, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |