RAB11A Rabbit Polyclonal Antibody

• Catalog Number: orb585750
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB11A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: RAB11A
• UniProt ID: P62491
• Protein Sequence: Synthetic peptide located within the following region: NVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK
• NCBI: NP_004654
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: YL8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

human Hela Cells and Monkey Vera.

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: Rab11a.

RAB11A antibody - C-terminal region (orb585750) validated by WB using Placenta Lysate at 1 ug/ml.

Rabbit Anti-RAB11A Antibody, Catalog Number: orb585750, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane in intercalated disc, cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAB11A Antibody, Positive Control: Lane 1: 60 ug human NT2 cell line Lane 2: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody dilution: 1:20000.