Cart summary

You have no items in your shopping cart.

R3HDM2 Rabbit Polyclonal Antibody (Biotin)

R3HDM2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2105521

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105521
CategoryAntibodies
DescriptionR3HDM2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human R3HDM2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW68kDa
UniProt IDQ9Y2K5
Protein SequenceSynthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
NCBINP_055740
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCAG6, PR01365
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.