QTRT1 Rabbit Polyclonal Antibody

• Catalog Number: orb580592
• Category: Antibodies
• Description: Rabbit polyclonal antibody to QTRT1
• Target: QTRT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human QTRT1
• Protein Sequence: Synthetic peptide located within the following region: FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG
• UniProt ID: Q9BXR0
• MW: 44 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TGT, TGUT, FP3235
• Note: For research use only
• NCBI: NP_112486

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml.

WB Suggested Anti-QTRT1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.