PWP2 antibody

• Catalog Number: orb325232
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PWP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PWP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 102kDa
• Target: PWP2
• UniProt ID: Q15269
• Protein Sequence: Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
• NCBI: NP_005040
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EHOC-17 antibody, anti PWP2H antibody, anti U
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 721_B tissue using PWP2 antibody

Western blot analysis of HepG2 cell lysate tissue using PWP2 antibody

Western blot analysis of human Jurkat tissue using PWP2 antibody

Western blot analysis of human MCF7 tissue using PWP2 antibody