You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325232 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PWP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PWP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 102kDa |
Target | PWP2 |
UniProt ID | Q15269 |
Protein Sequence | Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM |
NCBI | NP_005040 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti EHOC-17 antibody, anti PWP2H antibody, anti U Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-PWP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
Filter by Rating