PWP2 Rabbit Polyclonal Antibody

• Catalog Number: orb325232
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PWP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PWP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 102kDa
• Target: PWP2
• UniProt ID: Q15269
• Protein Sequence: Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
• NCBI: NP_005040
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EHOC-17 antibody, anti PWP2H antibody, anti U
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, PWP2 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-PWP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.