PUM3 Rabbit Polyclonal Antibody

• Catalog Number: orb577539
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PUM3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0020
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: PUM3
• UniProt ID: Q15397
• Protein Sequence: Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW
• NCBI: NP_001026861
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PEN, HA-8, PUF6, XTP5, PUF-A, HLA-HA8, KIAA0020
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Rabbit Anti-KIAA0020 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-KIAA0020 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. KIAA0020 is supported by BioGPS gene expression data to be expressed in HepG2.