You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577539 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PUM3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0020 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71kDa |
Target | PUM3 |
UniProt ID | Q15397 |
Protein Sequence | Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW |
NCBI | NP_001026861 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PEN, HA-8, PUF6, XTP5, PUF-A, HLA-HA8, KIAA0020 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Rabbit Anti-KIAA0020 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-KIAA0020 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. KIAA0020 is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
Biotin |