You have no items in your shopping cart.
Cart summary
Item 1 of 1
PTPN20A Rabbit Polyclonal Antibody
Catalog Number: orb587330
| Catalog Number | orb587330 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PTPN20A |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Porcine, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human PTPN20A |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 37kDa |
| Target | PTPN20A |
| UniProt ID | Q4JDL3 |
| Protein Sequence | Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CT126, PTPN20B, hPTPN20, bA142I17.1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
- Item 1 of 2
PTPN20 Rabbit Polyclonal Antibody [orb317724]
IF, IHC-Fr, IHC-P, WB
Human, Porcine
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl - Item 1 of 1
