PTPN2 Rabbit Polyclonal Antibody

• Catalog Number: orb579446
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PTPN2
• Target: PTPN2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTPN2
• Protein Sequence: Synthetic peptide located within the following region: LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS
• UniProt ID: Q96AU5
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PTN2, PTPT, TCPTP, TC-PTP, TCELLPTP
• Note: For research use only
• NCBI: NP_536348

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 5.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

WB Suggested Anti-PTPN2 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate. PTPN2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.