PSMC6 Rabbit Polyclonal Antibody

• Catalog Number: orb584311
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMC6
• Target: PSMC6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC6
• Protein Sequence: Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY
• UniProt ID: P62333
• MW: 44kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: p42, RPT5, SUG2
• Note: For research use only
• NCBI: NP_002797

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in MCF7.

Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: PSMC6.

WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.