Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PSMC6 Rabbit Polyclonal Antibody

SKU: orb584311

Description

Rabbit polyclonal antibody to PSMC6

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PSMC6
TargetPSMC6
Protein SequenceSynthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY
Molecular Weight44kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

p42, RPT5, SUG2

Similar Products

  • PSMC6 rabbit pAb Antibody [orb766145]

    IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PSMC6 Rabbit Polyclonal Antibody [orb556161]

    ICC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PSMC6 Rabbit Polyclonal Antibody [orb630307]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PSMC6 Rabbit Polyclonal Antibody [orb2955036]

    ELISA,  IHC,  WB

    Bovine, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Proteasome 19S 10B Rabbit Polyclonal Antibody [orb1458]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Porcine

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PSMC6 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in 721_B.

PSMC6 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in MCF7.

PSMC6 Rabbit Polyclonal Antibody

Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: PSMC6.

PSMC6 Rabbit Polyclonal Antibody

WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002797

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PSMC6 Rabbit Polyclonal Antibody (orb584311)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry