PSMC4 Rabbit Polyclonal Antibody

• Catalog Number: orb583282
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PSMC4
• UniProt ID: P43686
• Protein Sequence: Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
• NCBI: NP_006494
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S6, RPT3, TBP7, TBP-7, MIP224
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: PSMC4.

PSMC4 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb583282 with 1:200 dilution. Western blot was performed using orb583282 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: PSMC4 IP with orb583282 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-PSMC4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.