You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577576 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PSMA6 |
| Target | PSMA6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA6 |
| Protein Sequence | Synthetic peptide located within the following region: EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN |
| UniProt ID | P60900 |
| MW | 27kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | IOTA, p27K, PROS27 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Protei Read more... |
| Note | For research use only |
| NCBI | NP_002782 |

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml. PSMA6 is supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-PSMA6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PSMA6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review