PSMA6 Rabbit Polyclonal Antibody

• Catalog Number: orb577576
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMA6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: PSMA6
• UniProt ID: P60900
• Protein Sequence: Synthetic peptide located within the following region: EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN
• NCBI: NP_002782
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IOTA, p27K, PROS27
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml. PSMA6 is supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-PSMA6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PSMA6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.