PSIP1 Rabbit Polyclonal Antibody

• Catalog Number: orb575181
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSIP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSIP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60 kDa
• Target: PSIP1
• UniProt ID: O75475
• Protein Sequence: Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
• NCBI: NP_150091
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p52, p75, PAIP, DFS70, LEDGF, PSIP2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation, citrullination, and/or sumoylation.

Human Jurkat

WB Suggested Anti-PSIP1 Antibody, Positive Control: Lane 1: 5 ug mouse brain cytoplasm, Lane 2: 5 ug mouse brain nucleus, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-IR-dye, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-PSIP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, PSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.