PSG1 Rabbit Polyclonal Antibody

• Catalog Number: orb330233
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSG1
• Target: PSG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1
• Protein Sequence: Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
• UniProt ID: Q6ICR4
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti B1G1 antibody, anti CD66f antibody, anti DHFR
• Note: For research use only
• NCBI: NP_008836

WB Suggested Anti-PSG1 Antibody Titration: 2.5 ug/mL, Positive Control: NCI-H226 cell lysate, PSG1 is strongly supported by BioGPS gene expression data to be expressed in Human NCI-H226 cells.