PSG1 Rabbit Polyclonal Antibody

SKU: orb330232

Description

PSG1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of PSG1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PSG1. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSG1
• Target: PSG1
• Protein Sequence: Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
• Molecular Weight: 47kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti B1G1 antibody, anti CD66f antibody, anti DHFRP2 antibody, anti FLJ90598 antibody, anti FLJ90654 antibody, anti PBG1 antibody, anti PSBG1 antibody, anti PSGGA antibody, anti PSGIIA antibody, anti SP1 antibody

Quick Database Links

Gene Symbol

PSG1

UniProt

Q6ICR4

RefSeq (Protein):NP_008836