You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330232 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PSG1 |
| Target | PSG1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSG1 |
| Protein Sequence | Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE |
| UniProt ID | Q6ICR4 |
| MW | 47kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti B1G1 antibody, anti CD66f antibody, anti DHFR Read more... |
| Research Area | Signal Transduction |
| Note | For research use only |
| NCBI | NP_008836 |

Rabbit Anti-PSG1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PSG1 Antibody Titration: 1 ug/mL, Positive Control: Human placenta and mouse placenta.

WB Suggested Anti-PSG1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review