PRSS21 Rabbit Polyclonal Antibody

SKU: orb325880

Description

Rabbit polyclonal antibody to PRSS21

Research Area

Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS21
• Target: PRSS21
• Protein Sequence: Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ESP-1 antibody, anti ESP1 antibody, anti TEST1 antibody, anti TESTISIN antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-PRSS21 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain.

Quick Database Links

Gene Symbol

PRSS21

UniProt

Q9Y6M0

RefSeq (Protein):NP_659206