KIAA0515 Rabbit Polyclonal Antibody

SKU: orb325381

Description

Rabbit polyclonal antibody to PRRC2B

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0515
• Target: PRRC2B
• Protein Sequence: Synthetic peptide located within the following region: ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
• Molecular Weight: 48kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti RP11-334J6.1 antibody, anti DKFZp781F05101 antibody, anti DKFZp781K12107 antibody, anti LQFBS-1 antibody, anti MGC10526 antibody, anti BAT2L antibody, anti BAT2L1 antibody, anti KIAA0515 antibody

WB Suggested Anti-KIAA0515 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, PRRC2B is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

PRRC2B

UniProt

Q5JSZ5

RefSeq:EAW87968