PRPF19 Rabbit Polyclonal Antibody

• Catalog Number: orb578742
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRPF19
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPF19
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: PRPF19
• UniProt ID: Q9UMS4
• Protein Sequence: Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK
• NCBI: NP_055317
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-PRPF19 Antibody, Positive Control: Lane 1: 5 ug mouse brain cytoplasm, Lane 2: 5 ug mouse brain nucleus, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-IR-dye, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-PRPF19 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.