You have no items in your shopping cart.
PRKY Rabbit Polyclonal Antibody
SKU: orb583162
Description
Research Area
Epigenetics
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PRKY |
| Target | PRKY |
| Protein Sequence | Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD |
| Molecular Weight | 32kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PRKYP, PRKXP3
Similar Products
−PRKY Rabbit Polyclonal Antibody [orb319035]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μlPRKY (H93) polyclonal antibody [orb644015]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
25 μl, 200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-PRKY Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
Documents Download
Datasheet
Product Information
Request a Document
PRKY Rabbit Polyclonal Antibody (orb583162)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

