You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419297 |
---|---|
Category | Proteins |
Description | Recombinant Macaca mulatta Interleukin-10 |
Tag | C-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 20.7 kDa |
UniProt ID | P51496 |
Protein Sequence | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Biological Origin | Macaca mulatta (Rhesus macaque) |
Expression Region | 19-178aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Cytokine synthesis inhibitory factor Read more... |
Note | For research use only |
Application notes | Tag Info: C-terminal 10xHis-taggedExpression Region: 19-178aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
32.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
22.7 kDa | |
Baculovirus |
Greater than 85% as determined by SDS-PAGE. | |
21.2 kDa | |
Baculovirus |