You have no items in your shopping cart.
Cart summary
Item 1 of 1
Primate IL10 protein
Catalog Number: orb419303
| Catalog Number | orb419303 |
|---|---|
| Category | Proteins |
| Description | Recombinant Macaca mulatta Interleukin-10 |
| Tag | C-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P51496 |
| MW | 21.2 kDa |
| Application notes | Tag Info: C-terminal 10xHis-taggedExpression Region: 19-178aaSequence Info: Full Length |
| Endotoxins | Not test. |
| Source | Baculovirus |
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Expression Region | 19-178aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Cytokine synthesis inhibitory factor |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Primate IL10 protein [orb419287]
Greater than 90% as determined by SDS-PAGE.
22.7 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Primate IL10 protein [orb419297]
Greater than 85% as determined by SDS-PAGE.
20.7 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Primate IL10 protein [orb419017]
Greater than 90% as determined by SDS-PAGE.
32.7 kDa
E.coli
20 μg, 100 μg, 1 mg
