You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419314 |
---|---|
Category | Proteins |
Description | Recombinant Rhesus Macaque Interferon gamma active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 16.8 kDa |
UniProt ID | P63310 |
Protein Sequence | QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Expression System | 24-165aa |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 ×104 IU/mg. |
Expression Region | 24-165aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | IFN-gamma, Read more... |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 24-165aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Primate IFN gamma protein
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids. | |
Escherichia coli. |
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids. | |
Escherichia coli. |
Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids. | |
Escherichia coli |
Filter by Rating