You have no items in your shopping cart.
Primate IFN gamma protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 4 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 16.8 kDa |
| Expression Region | 24-165aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Rat Interferon-γ (rRtFN-γ) [orb1495057]
>95% by SDS-PAGE and HPLC analyses.
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.
Escherichia coli.
1 mg, 100 μg, 20 μgRecombinant Murine Interferon-γ (rMuIFN-γ) [orb1495059]
>95% by SDS-PAGE and HPLC analyses
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Escherichia coli.
1 mg, 20 μg, 100 μgRecombinant Human Interferon-γ (rHuIFN-γ) [orb1495064]
>98% by SDS-PAGE and HPLC analyses.
Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
Escherichia coli
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Primate IFN gamma protein (orb419314)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review