You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495059 |
---|---|
Category | Proteins |
Description | Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation. |
Form/Appearance | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose. |
Buffer/Preservatives | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose. |
Purity | > 95% by SDS-PAGE and HPLC analyses |
Protein Sequence | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
MW | Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids. |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Endotoxins | Less than 1EU/mg of rMuIFN-γ as determined by LAL method. |
Source | Escherichia coli. |
Biological Activity | encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.2- 0.8ng/mL, corresponding to a Specific Activity of >1.25 x 106 IU/mg. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Note | For research use only |