Cart summary

You have no items in your shopping cart.

PRIM2 Rabbit Polyclonal Antibody (FITC)

PRIM2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2113332

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2113332
CategoryAntibodies
DescriptionPRIM2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRIM2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW37kDa
UniProt IDQ5JU42
Protein SequenceSynthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS
NCBICAI42767
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesp58, PRIM2A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.