Cart summary

You have no items in your shopping cart.

PRICKLE3 Rabbit Polyclonal Antibody (FITC)

PRICKLE3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2135080

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2135080
CategoryAntibodies
DescriptionPRICKLE3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PRICKLE3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW68kDa
UniProt IDO43900
Protein SequenceSynthetic peptide located within the following region: GAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
NCBINP_006141
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPk3, LMO6, LOAM
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.