Cart summary

You have no items in your shopping cart.

PRELID3B Rabbit Polyclonal Antibody (FITC)

PRELID3B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2102685

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102685
CategoryAntibodies
DescriptionPRELID3B Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW21kDa
UniProt IDA5GFX0
Protein SequenceSynthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
NCBINP_057129
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSLMO2, C20orf45, dJ543J19.5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.