PRDM1 Rabbit Polyclonal Antibody

SKU: orb592827

Description

Rabbit polyclonal antibody to PRDM1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM1
• Target: PRDM1
• Protein Sequence: Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
• Molecular Weight: 92 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BLIMP1, PRDI-BF1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 77 kDa isoform. The protein may be modified by glycosylation.

Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/ml.

Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-PRDM1 antibody (orb592827).

WB Suggested Anti-PRDM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: SH-SYSY cell lysate.

Quick Database Links

Gene Symbol

PRDM1

UniProt

Q86WM7

RefSeq (Protein):NP_878911