You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592827 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PRDM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRDM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 92 kDa |
Target | PRDM1 |
UniProt ID | Q86WM7 |
Protein Sequence | Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |
NCBI | NP_878911 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BLIMP1, PRDI-BF1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 77 kDa isoform. The protein may be modified by glycosylation.
Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/ml.
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-PRDM1 antibody (orb592827).
WB Suggested Anti-PRDM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: SH-SYSY cell lysate.
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |