You have no items in your shopping cart.
Cart summary
Item 1 of 1
PRC1 Rabbit Polyclonal Antibody
Catalog Number: orb589284
Product Properties
| Catalog Number | orb589284 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PRC1 |
| Target | PRC1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRC1 |
| Protein Sequence | Synthetic peptide located within the following region: LWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETE |
| UniProt ID | H0YL53 |
| MW | 21 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ASE1 |
| Research Area | Cell Biology, Molecular Biology |
| Note | For research use only |
| NCBI | NP_001254509.1 |
Images
Sample Tissue: Human Lung Tumor lysates, Antibody Dilution: 1 ug/ml.
Similar Products
- Item 1 of 4
PRC1(Phospho-Thr481)rabbit pAb [orb771494]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 3
- Item 1 of 2
PRC1 Rabbit Polyclonal Antibody [orb100823]
IF, IHC-Fr, IHC-P
Canine, Equine, Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 1
Reviews
PRC1 Rabbit Polyclonal Antibody (orb589284)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review