PPP2R5A Rabbit Polyclonal Antibody

• Catalog Number: orb330528
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPP2R5A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: PPP2R5A
• UniProt ID: Q15172
• Protein Sequence: Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
• NCBI: NP_006234
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti B56A antibody, anti MGC131915 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PPP2R5A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.