You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330528 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PPP2R5A |
| Target | PPP2R5A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5A |
| Protein Sequence | Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
| UniProt ID | Q15172 |
| MW | 56kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti B56A antibody, anti MGC131915 antibody, anti Read more... |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_006234 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PPP2R5A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.
WB | |
Bovine, Equine, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review