Cart summary

You have no items in your shopping cart.

PPP1R15A Rabbit Polyclonal Antibody (HRP)

PPP1R15A Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2093315

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093315
CategoryAntibodies
DescriptionPPP1R15A Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW74kDa
UniProt IDO75807
Protein SequenceSynthetic peptide located within the following region: GMYGEREATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEE
NCBINP_055145
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesGADD34
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.