You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586036 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP1CC |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | PPP1CC |
UniProt ID | P63088 |
Protein Sequence | Synthetic peptide located within the following region: VTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPP |
NCBI | NP_002701 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PP1C, PP-1G, PPP1G Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-PPP1CC Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. PPP1CC is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |