Cart summary

You have no items in your shopping cart.

PPIP5K1 Rabbit Polyclonal Antibody (Biotin)

PPIP5K1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2094466

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094466
CategoryAntibodies
DescriptionPPIP5K1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PPIP5K1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW157kDa
UniProt IDQ6PFW1
Protein SequenceSynthetic peptide located within the following region: RPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGI
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesIP6K, IPS1, VIP1, hsVIP1, HISPPD2A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.