You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581362 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PPIA |
| Target | PPIA |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PPIA |
| Protein Sequence | Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| UniProt ID | P62937 |
| MW | 18kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CYPA, CYPH, HEL-S-69p |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_066953 |

Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml.

Human Intestine

WB Suggested Anti-PPIA Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. PPIA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review