Cart summary

You have no items in your shopping cart.

PPFIBP2 Rabbit Polyclonal Antibody (Biotin)

PPFIBP2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2089546

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089546
CategoryAntibodies
DescriptionPPFIBP2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PPFIBP2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW98kDa
UniProt IDQ8ND30
Protein SequenceSynthetic peptide located within the following region: LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA
NCBINP_003612
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCclp1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.