Pou3f3 Rabbit Polyclonal Antibody

• Catalog Number: orb583760
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pou3f3
• Target: Pou3f3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Canine, Mouse, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3
• Protein Sequence: Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS
• UniProt ID: Q63262
• MW: 54kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Brn1, RHS1
• Research Area: Epigenetics & Chromatin, Neuroscience, Stem Cell &
• Note: For research use only
• NCBI: NP_620192

Sample Type: Rat Testis lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-Pou3f3 Antibody, Catalog Number: orb583760, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-Pou3f3 antibody Titration: 1 ug/ml, Sample Type: Human heart.