POSTN Rabbit Polyclonal Antibody

• Catalog Number: orb578117
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POSTN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POSTN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: POSTN
• UniProt ID: Q15063
• Protein Sequence: Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ
• NCBI: NP_006466
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PN, OSF2, OSF-2, PDLPOSTN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-POSTN Antibody, Paraffin Embedded Tissue: Human Uterus, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-POSTN Antibody, Titration: 1 ug/ml, Positive Control: 293T cells lysate.