Cart summary

You have no items in your shopping cart.

POMK Rabbit Polyclonal Antibody (FITC)

POMK Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112207

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112207
CategoryAntibodies
DescriptionPOMK Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23356
Protein SequenceSynthetic peptide located within the following region: CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL
UniProt IDQ9H5K3
MW40kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesSGK196, MDDGA12, MDDGC12
NoteFor research use only
NCBINP_115613